PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011075490.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family TCP
Protein Properties Length: 370aa    MW: 39350.7 Da    PI: 9.8752
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011075490.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP91.41.9e-2860110252
             TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLl 52 
                     ++k+ +++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++tieWL 
  XP_011075490.1  60 PPKRASTKDRHTKVDGRGRRIRMPATCAARVFQLTRELGHKSDGETIEWLT 110
                     789**********************************************74 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.7E-2665168IPR005333Transcription factor, TCP
PROSITE profilePS5136919.76266120IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MDAGHGNAMH APNFPLQLLE KRDHRHHHHH REEACSTSTH LPVSAPNTSS NSSPQHKKPP  60
PKRASTKDRH TKVDGRGRRI RMPATCAARV FQLTRELGHK SDGETIEWLT GTGTIPANFT  120
SLNISARSSG STISAASHLR NNNYFSQNFA APQFRIRADN QWERSVEDSS ETERRRLLFP  180
GVGLASSDQT RMNFLSGNVN MNVNAMLQAK QELRDTGLEM AVAAAPEGEG SIGRKRRPEE  240
DLPPAVQTQM ANYMLQSSAG SIPASQGQIP ATTFLMNGES LWTFPSVGNS GIYRGSAVSS  300
SGLHLMNLPA SVTLLQGQQL ATGNEGGGGA VVDGHLGMLA ALNAFRSSPV GGGVAAEAHS  360
SGHGSGSAAG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0404882e-56KJ040488.1 Sesamum indicum clone TilSSR_11689 microsatellite Sesame_11689 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011075490.10.0PREDICTED: transcription factor TCP15-like
TrEMBLA0A022QL971e-116A0A022QL97_ERYGU; Uncharacterized protein
STRINGVIT_17s0000g06020.t011e-100(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28822351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69690.11e-41TCP family protein